Echistatin, α1 isoform

Cat. No. 3202

Echistatin, a1 isoform Glu-Cys-Glu-Ser-Gly-Pro-Cys-Cys-Arg-Asn-Cys-Lys-Phe-Leu-Lys-Glu-Gly-Thr-Ile-Cys-Lys-Arg-Ala-Arg-Gly-Asp-Asp-Met-Asp-Asp-Tyr-Cys-Asn-Gly-Lys-Thr-Cys-Asp-Cys-Pro-Arg-Asn-Pro-His-Lys-Gly-Pro-Ala-Thr

Price and Availability

For Echistatin, α1 isoform pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent irreversible αVβ3 integrin antagonist (Ki = 0.27 nM). Disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC50 = 0.1 nM). Prevents ADP-induced platelet aggregation via inhibition of glycoprotein IIb/IIIa (GpIIb/IIIa, αIIbβ3) receptors (IC50 = 30 nM) in vitro.

Technical Data

M.Wt:
5417.1
Formula:
C217H341N71O74S9
Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

(Modifications: Disulfide bridge between 2 - 11, 7 - 32, 8 - 37, 20 - 39)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
154303-05-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Kumar et al (1997) Biochemical characteriation of the binding of echistatin to integrin αVβ3 receptor. J.Pharmacol.Exp.Ther. 283 843. PMID: 9353406.

Musial et al (1990) Inhibition of platelet adhesion to surfaces of extracorporeal circuits by disintegrins RGD-containing peptides from viper venoms. Circulation 82 261. PMID: 2364514.

Sato et al (1990) Echistatin is a potent inhibitor of bone resorption in culture. J.Cell.Biol. 111 1713. PMID: 2211834.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Echistatin, α1 isoform from Tocris? If so please let us know.

View Related Products by Product Action

Keywords: Echistatin, a1 isoform, supplier, αVβ3, alphaVβ3, beta3, glycoprotein, IIb/IIIa, αIIbβ3, alphaIIbβ3, inhibitors, inhibits, Integrin, Receptors, Adhesion, Molecules, Echistatin, alpha1, isoform, Echistatina1, Tocris Bioscience, Integrin Receptor Inhibitor products

Quick Order

Find multiple products by catalog number

divider line

Immunology Guide

Immunology Product Listing

Our Immunology listing highlights over 190 products for immunology research. Request copy or view PDF today.

divider line

New Products in this Area

Cilengitide

Potent and selective inhibitor of integrins αvβ3 and αvβ5

SM 324405

Potent TLR7 agonist

RS 09

TLR4 peptide agonist; acts as an adjuvant in vivo

Sign-up for new product e-alerts
divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.