Echistatin, α1 isoform

Cat. No. 3202

Echistatin, alpha1 isoform Glu-Cys-Glu-Ser-Gly-Pro-Cys-Cys-Arg-Asn-Cys-Lys-Phe-Leu-Lys-Glu-Gly-Thr-Ile-Cys-Lys-Arg-Ala-Arg-Gly-Asp-Asp-Met-Asp-Asp-Tyr-Cys-Asn-Gly-Lys-Thr-Cys-Asp-Cys-Pro-Arg-Asn-Pro-His-Lys-Gly-Pro-Ala-Thr

Price and Availability

For Echistatin, α1 isoform pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent irreversible αVβ3 integrin antagonist (Ki = 0.27 nM). Disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC50 = 0.1 nM). Prevents ADP-induced platelet aggregation via inhibition of glycoprotein IIb/IIIa (GpIIb/IIIa, αIIbβ3) receptors (IC50 = 30 nM) in vitro.

Technical Data

M.Wt:
5417.1
Formula:
C217H341N71O74S9
Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

(Modifications: Disulfide bridge between 2 - 11, 7 - 32, 8 - 37, 20 - 39)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
154303-05-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Datasheet

Certificate of Analysis / Product Datasheet
Select another batch:

References are publications that support the products' biological activity.

Kumar et al (1997) Biochemical characteriation of the binding of echistatin to integrin αVβ3 receptor. J.Pharmacol.Exp.Ther. 283 843. PMID: 9353406.

Musial et al (1990) Inhibition of platelet adhesion to surfaces of extracorporeal circuits by disintegrins RGD-containing peptides from viper venoms. Circulation 82 261. PMID: 2364514.

Sato et al (1990) Echistatin is a potent inhibitor of bone resorption in culture. J.Cell.Biol. 111 1713. PMID: 2211834.

If you know of a relevant reference for Echistatin, α1 isoform please let us know.

Citations are publications that use Tocris products. Selected citations for Echistatin, α1 isoform include:

Lin et al (2013) Angiopoietin-like 3 induces podocyte F-actin rearrangement through integrin α(V)β3/FAK/PI3K pathway-mediated Rac1 activation. PLoS One 2013 135608. PMID: 24294595.

Schrader et al (2011) Matrix stiffness modulates proliferation, chemotherapeutic response, and dormancy in hepatocellular carcinoma cells. Biomed Res Int 53 1192. PMID: 21442631.

Do you know of a great paper that uses Echistatin, α1 isoform from Tocris? If so please let us know.

View Related Products by Product Action

Keywords: Echistatin, alpha1 isoform, supplier, αVβ3, alphaVβ3, beta3, glycoprotein, IIb/IIIa, αIIbβ3, alphaIIbβ3, inhibitors, inhibits, Integrin, Receptors, Adhesion, Molecules, Echistatin, alpha1, isoform, Echistatina1, alphavbeta3, Tocris Bioscience, Integrin Inhibitor products

Quick Order

Find multiple products by catalog number

divider line

Immunology Guide

Immunology Product Listing

Our Immunology listing highlights over 190 products for immunology research. Request copy or view PDF today.

divider line

New Products in this Area

BOP

Dual α9β/1α4β1 integrin inhibitor; preferentially mobilizes HSCs

ATN 161

α5β1 integrin receptor antagonist

FSL 1

TLR2/6 agonist (also a putative TLR10 ligand)

Sign-up for new product e-alerts
divider line

ISSCR 2017

Win a $1,000 travel grant

ISSCR Travel Grant 2017

Bio-Techne is offering 10 travel grants of $1,000 for ISSCR 2017.