Iberiotoxin

Cat. No. 1086

Iberiotoxin pGlu-Phe-Thr-Asp-Val-Asp-Cys-Ser-Val-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Lys-Asp-Leu-Phe-Gly-Val-Asp-Arg-Gly-Lys-Cys-Met-Gly-Lys-Lys-Cys-Arg-Cys-Tyr-Gln-OH (Disulfide bridge: C7-C28,C13-C33,C17-C35)

Price and Availability

For Iberiotoxin pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Selective blocker of the big conductance Ca2+-activated K+ channel.

Technical Data

M.Wt:
4230
Formula:
C179H274N50O55S7
Sequence:
XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ

(Modifications: X-1 = pGlu, Disulfide bridge between 7 - 28,13 - 33,17 - 35)

Solubility:
Soluble to 0.70 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
129203-60-7

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Suarez-Kurtz et al (1991) Effects of charybdotoxin and iberiotoxin on the spontaneous motility and tonus of different guinea-pig smooth muscle tissues. J.Pharmacol.Exp.Ther. 259 439. PMID: 1717682.

Galvez et al (1990) Purification and characterization of a unique, potent, peptidyl probe for the high conductance calcium-activated potassium channel from venom of the scorpion Buthus tamulus. J.Biol.Chem. 265 11083. PMID: 1694175.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for Iberiotoxin include:

Lai et al (2014) BK channels regulate sinoatrial node firing rate and cardiac pacing in vivo. Am J Physiol Heart Circ Physiol 307 H1327. PMID: 25172903.

Grassin-Delyle et al (2013) The expression and relaxant effect of bitter taste receptors in human bronchi. Respir Res 14 134. PMID: 24266887.

Mannowetz et al (2013) Slo1 is the principal potassium channel of human spermatozoa. Elife (Cambridge) 2 e01009. PMID: 24137539.

Benvindo et al (2011) Relaxant effect and possible mechanism of 17-nor-subincanadine E in rabbit corpora cavernosa. Asian J Androl 13 747. PMID: 21765439.

Zemkova et al (2011) Norepinephrine causes a biphasic change in mammalian pinealocye membrane potential: role of alpha1B-adrenoreceptors, phospholipase C, and Ca2+. Endocrinology 152 3842. PMID: 21828176.

Do you know of a great paper that uses Iberiotoxin from Tocris? If so please let us know.show all ▼show less ▲

View Related Products by Target

Keywords: Iberiotoxin, supplier, K+, channel, blockers, high, conductance, Ca2+-dependent, Potassium, KCa, Channels, ca2+-activated, ca2+-dependent, Tocris Bioscience, Calcium-Activated Potassium (KCa) Channel Blocker products

Quick Order

Find multiple products by catalog number

divider line

New Product Guide

New Product Guide (Spring/Summer 2016)

Our New Product guide highlights over 110 new products added in the first half of 2016. View PDF today.

divider line

New Products in this Area

BeKm 1

Potent and selective KV11.1 (hERG) channel blocker

Sign-up for new product e-alerts
divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.