Iberiotoxin

Cat. No. 1086

Iberiotoxin pGlu-Phe-Thr-Asp-Val-Asp-Cys-Ser-Val-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Lys-Asp-Leu-Phe-Gly-Val-Asp-Arg-Gly-Lys-Cys-Met-Gly-Lys-Lys-Cys-Arg-Cys-Tyr-Gln-OH (Disulfide bridge: C7-C28,C13-C33,C17-C35)

Price and Availability

For Iberiotoxin pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Selective blocker of the big conductance Ca2+-activated K+ channel.

Technical Data

M.Wt:
4230
Formula:
C179H274N50O55S7
Sequence:
XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ

(Modifications: X-1 = pGlu, Disulfide bridge between 7 - 28,13 - 33,17 - 35)

Solubility:
Soluble to 0.70 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
129203-60-7

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Certificate of Analysis / Product Datasheet
Select another batch:

Suarez-Kurtz et al (1991) Effects of charybdotoxin and iberiotoxin on the spontaneous motility and tonus of different guinea-pig smooth muscle tissues. J.Pharmacol.Exp.Ther. 259 439. PMID: 1717682.

Galvez et al (1990) Purification and characterization of a unique, potent, peptidyl probe for the high conductance calcium-activated potassium channel from venom of the scorpion Buthus tamulus. J.Biol.Chem. 265 11083. PMID: 1694175.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for Iberiotoxin include:

Hirono et al (2015) BK Channels Localize to the Paranodal Junction and Regulate Action Potentials in Myelinated Axons of Cerebellar Purkinje Cells. Am J Physiol Cell Physiol 35 7082. PMID: 25948259.

Lai et al (2014) BK channels regulate sinoatrial node firing rate and cardiac pacing in vivo. Am J Physiol Heart Circ Physiol 307 H1327. PMID: 25172903.

Needham et al (2014) The role of K+ and Cl- channels in the regulation of retinal arteriolar tone and blood flow. FASEB J 55 2157. PMID: 24609622.

Grassin-Delyle et al (2013) The expression and relaxant effect of bitter taste receptors in human bronchi. Respir Res 14 134. PMID: 24266887.

Kyle et al (2013) Mechanisms underlying activation of transient BK current in rabbit urethral smooth muscle cells and its modulation by IP3-generating agonists. Invest Ophthalmol Vis Sci 305 C609. PMID: 23804200.

Mannowetz et al (2013) Slo1 is the principal potassium channel of human spermatozoa. Elife (Cambridge) 2 e01009. PMID: 24137539.

Wan et al (2013) Reduced vascular smooth muscle BK channel current underlies heart failure-induced vasoconstriction in mice. Mol Pain 27 1859. PMID: 23325318.

Benvindo et al (2011) Relaxant effect and possible mechanism of 17-nor-subincanadine E in rabbit corpora cavernosa. Asian J Androl 13 747. PMID: 21765439.

Zemkova et al (2011) Norepinephrine causes a biphasic change in mammalian pinealocye membrane potential: role of alpha1B-adrenoreceptors, phospholipase C, and Ca2+. Endocrinology 152 3842. PMID: 21828176.

Do you know of a great paper that uses Iberiotoxin from Tocris? If so please let us know.show all ▼show less ▲

View Related Products by Target

Keywords: Iberiotoxin, supplier, K+, channel, blockers, high, conductance, Ca2+-dependent, Potassium, KCa, Channels, ca2+-activated, ca2+-dependent, Tocris Bioscience, Calcium-Activated Potassium (KCa) Channel Blocker products

Quick Order

Find multiple products by catalog number

divider line

New Product Guide

New Product Guide (Fall/Winter 2016)

Our New Product guide highlights over 100 new products added in the second half of 2016. Request copy or view PDF today.

divider line

New Products in this Area

BeKm 1

Potent and selective KV11.1 (hERG) channel blocker

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.