[Ala11,22,28]VIP

Cat. No. 1386

[Ala11,22,28]VIP His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Ala-Leu-Asn-Ser-Ile-Leu-Ala-NH2

Price and Availability

For [Ala11,22,28]VIP pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent and highly selective agonist for the human VPAC1 receptor (Ki values are 7.4 and 2352 nM for binding to human recombinant VPAC1 and VPAC2 receptors respectively).

Technical Data

M.Wt:
3160.68
Formula:
C139H231N43O39S
Sequence:
HSDAVFTDNYARLRKQMAVKKALNSILA-NH2
Storage:
Desiccate at -20°C
CAS No:
291524-04-4

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Nicole et al (2000) Identification of key residues for interaction of vasoactive intestinal peptide with human VPAC1 and VPAC2 receptors and development of a highly selective VPAC1 agonist. J.Biol.Chem. 275 24003. PMID: 10801840.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses [Ala11,22,28]VIP from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: [Ala11,22,28]VIP, supplier, Potent, selective, VPAC1, agonists, Vasoactive, Intestinal, Peptide, Receptors, VPAC, VIP, Tocris Bioscience, VIP Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs. Request copy or view PDF today.

divider line

New Therapies and Challenges in Asthma

Written by Peter J. Barnes

Asthma Life Science Poster

Our Asthma poster highlights key pathways and new therapies used to treat asthma, including those currently in clinical development. Request copy today.

divider line

New Products in this Area

Spexin

Potent GAL2/3 agonist; exhibits anxiolytic effects in vivo

MM 54

Potent apelin receptor antagonist

MSG 606

Potent human MC1 receptor antagonist; also MC3 and MC5 partial agonist

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.