Nocistatin (human)

Cat. No. 1198

Nocistatin (human) Met-Pro-Arg-Val-Arg-Ser-Leu-Phe-Gln-Glu-Gln-Glu-Glu-Pro-Glu-Pro-Gly-Met-Glu-Glu-Ala-Gly-Glu-Met-Glu-Gln-Lys-Gln-Leu-Gln

Price and Availability

For Nocistatin (human) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Human putative counterpart of nocistatin (bovine). Blocks nociceptin-induced allodynia and hyperalgesia.

Technical Data

M.Wt:
3561.93
Formula:
C149H238N42O53S3
Sequence:
MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ
Storage:
Desiccate at -20°C
CAS No:
212609-11-5

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis is currently unavailable
on-line. Please contact Customer Service
Safety Data Sheet: View Safety Data Sheet

Okuda-Ashitaka and Ito (2000) Nocistatin: a novel neuropeptide encoded by the gene for the nociceptin/orphanin FQ precursor. Peptides 21 1101. PMID: 10998544.

Minami et al (1998) Anti-nociceptive responses produced by human putative counterpart of nocistatin. Br.J.Pharmacol. 124 1016. PMID: 9720768.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for Nocistatin (human) include:

Laudenbach et al (2001) Nociceptin/orphanin FQ exacerbates excitotoxic white-matter lesions in the murine neonatal brain. J Clin Invest 107 457. PMID: 11181645.

Do you know of a great paper that uses Nocistatin (human) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Nocistatin (human), supplier, Human, putative, counterpart, nocistatin, Nociceptin, Receptors, ORL1, OP4, NOP, Opioid, antagonists, Tocris Bioscience, NOP Receptor Antagonist products

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Product Guide

Our Pain guide highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

Peripheral Sensitization

Written by Grant D. Nicol and Michael R. Vasko

Pain Life Science Poster

Our Peripheral Sensitization poster gives a summary of the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. Request copy or view PDF today.

divider line

Regulation of Vascular Reactivity by GPCRs

Written by J.J. Maguire and A.P. Davenport

Cardiovascular Life Science Poster

Our Cardiovascular poster highlights the key G protein-coupled receptors involved in the regulation of vascular reactivity. Request copy today.

divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.