Apelin-36 (rat, mouse)

Cat. No. 2427

Apelin-36 (rat, mouse) Leu-Val-Lys-Pro-Arg-Thr-Ser-Arg-Thr-Gly-Pro-Gly-Ala-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe

Price and Availability

For Apelin-36 (rat, mouse) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Endogenous APJ receptor agonist that is secreted by adipocytes. Binds with high affinity to APJ receptors (IC50 = 5.4 nM) and potently inhibits cAMP production in vitro (EC50 = 0.52 nM). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.

Technical Data

M.Wt:
4200.93
Formula:
C185H304N68O43S
Sequence:
LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
Solubility:
Soluble to 1.60 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
230299-95-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Kawamata et al (2001) Molecular properties of apelin: tissue distribution and receptor binding. Biochim.Biophys.Acta 1538 162. PMID: 11336787.

Zou et al (2000) Apelin peptides block the entry of human immunodeficiency virus (HIV). FEBS Lett. 473 15. PMID: 10802050.

Tatemoto et al (1998) Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem.Biophys.Res.Comm. 251 471.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Apelin-36 (rat, mouse) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Apelin-36 (rat, mouse), supplier, Endogenous, APJ, receptors, agonists, Apelin, adipokines, Tocris Bioscience, Apelin Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Product Guide

Our Cardiovascular Guide highlights over 250 products for cardiovascular research. Request copy or view PDF today.

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs. Request copy or view PDF today.

divider line

Regulation of Vascular Reactivity by GPCRs

Written by J.J. Maguire and A.P. Davenport

Cardiovascular Life Science Poster

Our Cardiovascular poster highlights the key G protein-coupled receptors involved in the regulation of vascular reactivity. Request copy today.

divider line

New Products in this Area

Calcitonin (human)

Endogenous calcitonin receptor agonist; inhibits bone resorption

Spexin

Potent GAL2/3 agonist; exhibits anxiolytic effects in vivo

MM 54

Potent apelin receptor antagonist

MSG 606

Potent human MC1 receptor antagonist; also MC3 and MC5 partial agonist

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.