Apelin-36 (human)

Cat. No. 2426

Apelin-36 (human) Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe

Price and Availability

For Apelin-36 (human) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Endogenous APJ receptor agonist (EC50 = 20 nM) that is secreted by adipocytes. Binds with high affinity to human APJ receptors expressed in HEK 293 cells (pIC50= 8.61). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.

Technical Data

M.Wt:
4195.87
Formula:
C184H297N69O43S
Sequence:
LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
252642-12-9

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Medhurst et al (2003) Pharmacological and immunohistochemical characterization of the APJ receptor and its endogenous ligand apelin. J.Neurochem. 84 1162. PMID: 12603839.

Zou et al (2000) Apelin peptides block the entry of human immunodeficiency virus (HIV). FEBS Lett. 473 15. PMID: 10802050.

Tatemoto et al (1998) Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem.Biophys.Res.Comm. 251 471.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Apelin-36 (human) from Tocris? If so please let us know.

View Related Products by Target

Keywords: Apelin-36 (human), supplier, Endogenous, APJ, receptors, agonists, Apelin, adipokines, Tocris Bioscience

Quick Order

Find multiple products by catalog number

divider line

New Product Guide

New Product Guide (Fall/Winter 2016)

Our New Product guide highlights over 100 new products added in the second half of 2016. Request copy or view PDF today.

divider line

Bio-Techne Events

One Day Symposium

Bio-Techne Symposium 2017

Epigenetic Regulation of Stem Cell Differentiation

March 1, 2017

Amsterdam, The Netherlands