Neuropeptide Y (human, rat)

Cat. No. 1153

Neuropeptide Y (human, rat) Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2

Price and Availability

For Neuropeptide Y (human, rat) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: NPY (human, rat)

Biological Activity

Widely distributed endogenous neuropeptide involved in the control of food intake, sexual behavior and blood pressure.

Technical Data

M.Wt:
4271.7
Formula:
C189H285N55O57S
Sequence:
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

(Modifications: Tyr-36 = C-terminal amide)

Solubility:
Soluble to 1.50 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
90880-35-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Michel et al (1998) XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 50 143. PMID: 9549761.

Allen et al (1987) Molecular structure of mammalian neuropeptide Y: analysis by molecular cloning and computer-aided comparison with crystal structure of avian homologue. Proc.Natl.Acad.Sci.U.S.A. 84 2532. PMID: 3031687.

Minth et al (1984) Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine. Proc.Natl.Acad.Sci.U.S.A. 81 4577. PMID: 6589611.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for Neuropeptide Y (human, rat) include:

Singer et al (2013) Neuropeptide Y is produced by adipose tissue macrophages and regulates obesity-induced inflammation. PLoS One 8 e57929. PMID: 23472120.

Do you know of a great paper that uses Neuropeptide Y (human, rat) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Neuropeptide Y (human, rat), supplier, Influences, feeding, sexual, behavior, Neuropeptide, Y, Receptors, NPY, agonists, NeuropeptideY, (human), neuropeptides, Neuropeptide, Y, (human,, rat), Tocris Bioscience, NPY Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

Regulation of Vascular Reactivity by GPCRs

Written by J.J. Maguire and A.P. Davenport

Cardiovascular Life Science Poster

Our Cardiovascular poster highlights the key G protein-coupled receptors involved in the regulation of vascular reactivity. Request copy today.

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Life Science Poster

Our Gut Hormones and the Regulation of Appetite poster gives an overview of the neuropeptide modulators and gut hormones that influence appetite. Request copy today.

divider line

New Products in this Area

Neuropeptide S (Mouse)

Potent endogenous neuropeptide S receptor (NPSR) agonist

ML 382

MrgX1 (SNSR4) positive allosteric modulator

K-(D-1-Nal)-FwLL-NH2

High affinity and potent ghrelin receptor inverse agonist

Neuropeptide S (Rat)

Potent endogenous neuropeptide S receptor agonist

Neuropeptide S (human)

Potent endogenous neuropeptide S receptor agonist

Sign-up for new product e-alerts
divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.