Metastin (human)

Cat. No. 1443

Metastin (human) Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2

Price and Availability

For Metastin (human) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Names: Kisspeptin-54, Kp-54

Biological Activity

Potent endogenous ligand of the kisspeptin receptor (KISS1, GPR54). Binds with high affinity to rat and human KISS1 receptors with Ki values of 1.80 and 1.45 nM respectively. Inhibits chemotaxis, invasion and metastasis of human melanomas and breast carcinomas. Stimulates gonadotropin secretion following i.c.v. administration.

Technical Data

M.Wt:
5857.49
Formula:
C258H401N79O78
Sequence:
GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF

(Modifications: Phe-54 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
374683-24-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Gottsch et al (2004) A role for kisspeptins in the regulation of gonadotropin secretion in the mouse. Endocrinology 145 4073. PMID: 15217982.

Kotani et al (2001) The metastasis suppressor gene KiSS-1 encodes kisspeptins, the natural ligands of the orphan G protein-coupled receptor GPR54. J.Biol.Chem. 276 34631. PMID: 11457843.

Ohtaki et al (2001) Metastasis suppressor gene KiSS-1 encodes peptide ligand of a G-protein-coupled receptor. Nature 411 613. PMID: 11385580.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for Metastin (human) include:

Fayazi et al (2015) The pregnant mouse uterus exhibits a functional kisspeptin/KISS1R signaling system on the day of embryo implantation. Nat Chem Biol 13 105. PMID: 26384646.

Do you know of a great paper that uses Metastin (human) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Metastin (human), supplier, Potent, endogenous, ligand, KISS1, receptors, hOT7T175, AXOR12, GPR54, Metastin, KISS-derived, Peptides, Kisspeptin, Tocris Bioscience, Kisspeptin Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Cancer Research Product Guide

Cancer Research Product Guide

Our Cancer Research Guide highlights over 750 products for cancer research. Request copy or view PDF today.

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs. Request copy or view PDF today.

divider line

New Products in this Area

Spexin

Potent GAL2/3 agonist; exhibits anxiolytic effects in vivo

MM 54

Potent apelin receptor antagonist

MSG 606

Potent human MC1 receptor antagonist; also MC3 and MC5 partial agonist

Sign-up for new product e-alerts
divider line

Bio-Techne Events

ASCB 2016

ASCB 2016

December 3 - 7, 2016

San Francisco, CA,

Booth: 314