Metastin (human)

Cat. No. 1443

Metastin (human) Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2

Price and Availability

For Metastin (human) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Names: Kisspeptin-54, Kp-54

Biological Activity

Potent endogenous ligand of the kisspeptin receptor (KISS1, GPR54). Binds with high affinity to rat and human KISS1 receptors with Ki values of 1.80 and 1.45 nM respectively. Inhibits chemotaxis, invasion and metastasis of human melanomas and breast carcinomas. Stimulates gonadotropin secretion following i.c.v. administration.

Technical Data

M.Wt:
5857.49
Formula:
C258H401N79O78
Sequence:
GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF

(Modifications: Phe-54 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
374683-24-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Gottsch et al (2004) A role for kisspeptins in the regulation of gonadotropin secretion in the mouse. Endocrinology 145 4073. PMID: 15217982.

Kotani et al (2001) The metastasis suppressor gene KiSS-1 encodes kisspeptins, the natural ligands of the orphan G protein-coupled receptor GPR54. J.Biol.Chem. 276 34631. PMID: 11457843.

Ohtaki et al (2001) Metastasis suppressor gene KiSS-1 encodes peptide ligand of a G-protein-coupled receptor. Nature 411 613. PMID: 11385580.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Metastin (human) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Metastin (human), supplier, Potent, endogenous, ligand, KISS1, receptors, hOT7T175, AXOR12, GPR54, Metastin, KISS-derived, Peptides, Kisspeptin, Tocris Bioscience, Kisspeptin Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Cancer Research Product Guide

Cancer Research Product Guide

Our Cancer Research Guide highlights over 750 products for cancer research. Request copy or view PDF today.

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs Request copy or view PDF today.

divider line

New Products in this Area

MSG 606

Potent human MC1 receptor antagonist; also MC3 and MC5 partial agonist

Neuropeptide S (Mouse)

Potent endogenous neuropeptide S receptor (NPSR) agonist

ML 382

MrgX1 (SNSR4) positive allosteric modulator

K-(D-1-Nal)-FwLL-NH2

High affinity and potent ghrelin receptor inverse agonist

Neuropeptide S (Rat)

Potent endogenous neuropeptide S receptor agonist

Neuropeptide S (human)

Potent endogenous neuropeptide S receptor agonist

Sign-up for new product e-alerts
divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.