Galanin (1-30) (human)

Cat. No. 1179

Galanin (1-30) (human) Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser

Price and Availability

For Galanin (1-30) (human) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Endogenous peptide with multiple endocrine, metabolic and behavioral effects. Has been shown to have an action on intestinal smooth muscle, insulin and somatostatin release, and synaptic neurotransmission.

Technical Data

M.Wt:
3157.41
Formula:
C139H210N42O43
Sequence:
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Solubility:
Soluble to 0.50 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
119418-04-1

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Niiro et al (1998) Mechanisms of galanin-induced contraction in the rat myometrium. Br.J.Pharmacol. 124 1623. PMID: 9756377.

Wang et al (1998) Hypothalamic galanin: control by signals of fat metabolism. Brain Res. 804 7. PMID: 9729239.

Schmidt et al (1991) Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide. Proc.Natl.Acad.Sci.U.S.A. 88 11435. PMID: 1722333.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for Galanin (1-30) (human) include:

Chiu et al (2013) Bacteria activate sensory neurons that modulate pain and inflammation. Nature 501 52. PMID: 23965627.

Do you know of a great paper that uses Galanin (1-30) (human) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Galanin (1-30) (human), supplier, Endogenous, galanin, agonists, GAL, GalR, Receptors, Galanin, Tocris Bioscience, Galanin Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Life Science Poster

Our Gut Hormones and the Regulation of Appetite poster gives an overview of the neuropeptide modulators and gut hormones that influence appetite. Request copy today.

divider line

New Products in this Area

Neuropeptide S (Mouse)

Potent endogenous neuropeptide S receptor (NPSR) agonist

ML 382

MrgX1 (SNSR4) positive allosteric modulator

K-(D-1-Nal)-FwLL-NH2

High affinity and potent ghrelin receptor inverse agonist

Neuropeptide S (Rat)

Potent endogenous neuropeptide S receptor agonist

Neuropeptide S (human)

Potent endogenous neuropeptide S receptor agonist

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.