CRF (human, rat)

Cat. No. 1151

CRF (human, rat) Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2

Price and Availability

For CRF (human, rat) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: Corticotropin-Releasing Factor (human, rat)

Biological Activity

Endogenous peptide agonist for the CRF receptor (Ki values are 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively). Stimulates the synthesis and release of ACTH from the anterior pituitary.

Licensing Information

Sold with the permission of the SALK Institute

Technical Data

M.Wt:
4758
Formula:
C208H344N60O63S2
Sequence:
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

(Modifications: Ile-41 = C-terminal amide)

Solubility:
Soluble to 1.10 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
86784-80-7

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Perrin and Vale (1999) Corticotropin releasing factor receptors and their ligand family. Ann.N.Y.Acad.Sci. 885 312. PMID: 10816663.

Rivier et al (1986) Mediation by corticotropin releasing factor (CRF) of adenohypophysial hormone secretion. Annu.Rev.Physiol. 48 475. PMID: 2871808.

Souza et al (1984) Corticotropin-releasing factor receptors in rat forebrain: autoradiographic identification. Science 224 1449. PMID: 6328656.

Tache et al (1983) Inhibition of gastric acid secretion in rats by intracerebral injection of corticotropin-releasing factor. Science 222 935. PMID: 6415815.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for CRF (human, rat) include:

Gray et al (2015) Corticotropin-releasing hormone drives anandamide hydrolysis in the amygdala to promote anxiety. J Neurosci 35 3879. PMID: 25740517.

Lowery-Gionta et al (2012) Corticotropin releasing factor signaling in the central amygdala is recruited during binge-like ethanol consumption in C57BL/6J mice. J Neurosci 32 3405. PMID: 22399763.

Land et al (2008) The dysphoric component of stress is encoded by activation of the dynorphin kappa-opioid system. J Neurosci 28 407. PMID: 18184783.

Dermitzaki et al (2007) Corticotropin-releasing factor (CRF) and the urocortins differentially regulate catecholamine secretion in human and rat adrenals, in a CRF receptor type-specific manner. Endocrinology 148 1524. PMID: 17194738.

Do you know of a great paper that uses CRF (human, rat) from Tocris? If so please let us know.show all ▼show less ▲

View Related Products by Target

View Related Products by Product Action

Keywords: CRF (human, rat), supplier, Stimulates, ACTH, release, Corticotropin-Releasing, Factor, Non-Selective, CRF, Receptors, agonists, Tocris Bioscience, Non-selective CRF Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs Request copy or view PDF today.

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Life Science Poster

Our Gut Hormones and the Regulation of Appetite poster gives an overview of the neuropeptide modulators and gut hormones that influence appetite. Request copy today.

divider line

Antidepressants - Current and Future Targets

Written by P. Skolnich et al

Depression Life Science Poster

Our Depression poster highlights presynaptic and postsynaptic targets for the potential treatment of major depressive disorder. Request copy or view PDF today.

divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.