Charybdotoxin

Cat. No. 1087

Charybdotoxin Glp-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH (Disulfide bridge: 7-28, 13-33 and 17-35)

Price and Availability

For Charybdotoxin pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: ChTx

Biological Activity

Specific inhibitor of the big conductance Ca2+-activated K+ channel.

Technical Data

M.Wt:
4295.95
Formula:
C176H277N57O55S7
Sequence:
XFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS

(Modifications: X-1 = Glp, Disulfide bridge between 7 - 28, 13 - 33,17 - 35, Ser-37 = C-terminal OH)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
95751-30-7

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Asano et al (1993) Charybdotoxin-sensitive K+ channels regulate the myogenic tone in the resting state of arteries from spontaneously hypertensive rats. Br.J.Pharmacol. 108 214. PMID: 7679030.

Gimenez-Gallego et al (1988) Purification, sequence, and model structure of charybdotoxin, a potent selective inhibitor of calcium activated potassium channels. Proc.Natl.Acad.Sci.U.S.A. 85 3329. PMID: 2453055.

Miller et al (1985) Charybdotoxin, a protein inhibitor of single Ca2+ activated K+ channels from mammalian skeletal muscle. Nature 313 316. PMID: 2578618.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for Charybdotoxin include:

Mannowetz et al (2013) Slo1 is the principal potassium channel of human spermatozoa. Elife (Cambridge) 2 e01009. PMID: 24137539.

Ohya et al (2011) Involvement of dominant-negative spliced variants of the intermediate conductance Ca2+-activated K+ channel, K(Ca)3.1, in immune function of lymphoid cells. J Biol Chem 286 16940. PMID: 21345794.

Do you know of a great paper that uses Charybdotoxin from Tocris? If so please let us know.

View Related Products by Target

Keywords: Charybdotoxin, supplier, K+, channel, blockers, high, conductance, Ca2+-dependent, Potassium, KCa, Channels, ca2+-activated, ca2+-dependent, Tocris Bioscience, Calcium-Activated Potassium (KCa) Channel Blocker products

Quick Order

Find multiple products by catalog number

divider line

New Product Guide

New Product Guide (Spring/Summer 2016)

Our New Product guide highlights over 110 new products added in the first half of 2016. View PDF today.

divider line

New Products in this Area

BeKm 1

Potent and selective KV11.1 (hERG) channel blocker

Sign-up for new product e-alerts
divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.