α-Bungarotoxin

Cat. No. 2133

a-Bungarotoxin Ile-Val-Cys-His-Thr-Thr-Ala-Thr-Ser-Pro-Ile-Ser-Ala-Val-Thr-Cys-Pro-Pro-Gly-Glu-Asn-Leu-Cys-Tyr-Arg-Lys-Met-Trp-Cys-Asp-Ala-Phe-Cys-Ser-Ser-Arg-Gly-Lys-Val-Val-Glu-Leu-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ser-Lys-Lys-Pro-Tyr-Glu-Glu-Val-Thr-Cys-Cys-Ser-Thr-Asp-Lys

Price and Availability

For α-Bungarotoxin pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Names: α-Bgtx, α-BuTX

Biological Activity

Neurotoxin that blocks neuromuscular transmission via irreversible inhibition of nicotinic ACh receptors (nAChRs). Prevents opening of nicotinic receptor-associated ion channels and is selective for α7 receptors over α3β4 receptors (IC50 values are 1.6 nM and > 3 μM respectively).

Technical Data

M.Wt:
7984.14
Formula:
C338H529N97O105S11
Sequence:
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG

(Modifications: Disulfide bridge between 3 - 23, 16 - 44, 29 - 33, 48 - 59, 60 - 65)

Solubility:
Soluble in water
Storage:
Desiccate at -20°C
CAS No:
11032-79-4

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Product Datasheet / Safety Data Sheet

Certificate of Analysis / Product Datasheet
Select another batch:

Lopez et al (1998) Unmasking the functions of the chromaffin cell α7 nicotinic receptor by using short pulses of acetylcholine and selective blockers. Proc.Natl.Acad.Sci.USA 95 14184.

Zhang et al (1994) Neuronal acetylcholine receptors that bind α-bungarotoxin with high affinity function as ligand-gated ion channels. Neuron 12 167. PMID: 7507338.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products. Selected citations for α-Bungarotoxin include:

Miyamoto et al (2016) Increasing the Receptor Tyrosine Kinase EphB2 Prevents Amyloid-β-induced Depletion of Cell Surface Glutamate Receptors by a Mechanism That Requires the PDZ-binding Motif of EphB2 and Neuronal Activity. J Neurosci 291 1719. PMID: 26589795.

Bader and Diener (2015) Novel aspects of cholinergic regulation of colonic ion transport. J Biol Chem 3 e00139. PMID: 26236483.

Bryant et al (2015) Cholinergic control of γ power in the midbrain spatial attention network. Proc Natl Acad Sci U S A 35 761. PMID: 25589769.

Chatzidaki et al (2015) The influence of allosteric modulators and transmembrane mutations on desensitisation and activation of α7 nicotinic acetylcholine receptors. PLoS One 97 75. PMID: 25998276.

Gill-Thind et al (2015) Structurally similar allosteric modulators of α7 nicotinic acetylcholine receptors exhibit five distinct pharmacological effects. J Biol Chem 290 3552. PMID: 25516597.

Li (2015) Selective Gating of Neuronal Activity by Intrinsic Properties in Distinct Motor Rhythms. Neurotherapeutics 35 9799. PMID: 26156983.

Singh et al (2015) Norepinephrine is required to promote wakefulness and for hypocretin-induced arousal in zebrafish. Elife 4. PMID: 26374985.

Spurny et al (2015) Molecular blueprint of allosteric binding sites in a homologue of the agonist-binding domain of the α7 nicotinic acetylcholine receptor. Neuropharmacology 112 E2543. PMID: 25918415.

Ślimak et al (2014) Habenular expression of rare missense variants of the β4 nicotinic receptor subunit alters nicotine consumption. Front Hum Neurosci 8 12. PMID: 24478678.

Macpherson et al (2014) The α 7 nicotinic receptor agonist PHA-543613 hydrochloride inhibits Porphyromonas gingivalis-induced expression of interleukin-8 by oral keratinocytes. J Neurosci 63 557. PMID: 24609617.

Kamynina et al (2013) Acetylcholine and antibodies against the acetylcholine receptor protect neurons and astrocytes against beta-amyloid toxicity. Int J Biochem Cell Biol 45 899. PMID: 23353645.

Moult et al (2013) Fast silencing reveals a lost role for reciprocal inhibition in locomotion. Neuron 77 129. PMID: 23312521.

Némethova et al (2013) Nicotine attenuates activation of tissue resident macrophages in the mouse stomach through the β2 nicotinic acetylcholine receptor. Inflamm Res 8 e79264. PMID: 24223920.

Sala et al (2013) CC4, a dimer of cytisine, is a selective partial agonist at α4β2/α6β2 nAChR with improved selectivity for tobacco smoking cessation. Br J Pharmacol 168 835. PMID: 22957729.

Zhong et al (2013) Nicotine elicits prolonged calcium signaling along ventral hippocampal axons. Pharmacol Res Perspect 8 e82719. PMID: 24349346.

Krais et al (2011) CHRNA5 as negative regulator of nicotine signaling in normal and cancer bronchial cells: effects on motility, migration and p63 expression. Carcinogenesis 32 1388. PMID: 21586512.

Demarque and Spitzer (2010) Activity-dependent expression of Lmx1b regulates specification of serotonergic neurons modulating swimming behavior. Neuron 67 321. PMID: 20670838.

Sun et al (2009) Rosiglitazone inhibits alpha4 nicotinic acetylcholine receptor expression in human lung carcinoma cells through peroxisome proliferator-activated receptor gamma-independent signals. Mol Cancer Ther 8 110. PMID: 19139119.

Do you know of a great paper that uses α-Bungarotoxin from Tocris? If so please let us know.show all ▼show less ▲

View Related Products by Target

View Related Products by Product Action

Keywords: a-Bungarotoxin, supplier, α7, alpha7, a7, subtype-selective, nAChR, antagonists, Nicotinic, Receptors, Acetylcholine, α-Bungarotoxin, alpha-Bungarotoxin, neurotoxins, Bungarotoxin, alpha-Bgtx, alpha-BuTX, Tocris Bioscience, Nicotinic (α7) Receptor Antagonist products

Quick Order

Find multiple products by catalog number

divider line

Pain Research Product Guide

Pain Research Product Guide

Our Pain guide highlights over 280 products for Pain research. Request copy or view PDF today.

divider line

Neurodegeneration Research Product Guide

Neurodegeneration Product Guide

Our Neurodegeneration guide highlights over 275 products for neurodegeneration research. Request copy or view PDF today.

divider line

Nicotinic ACh Review

Written by Susan Wonnacott

Nicotinic ACh Receptors Scientific Review

Our Nicotinic Acetylcholine Receptor review summarizes the structure and function of nAChR receptors, and the pharmacological ligands used to study them. Request copy or view PDF today.

divider line

Alzheimer's Disease: Neurobiology and Drug Targets

Written by Alan Palmer

Alzheimer's Life Science Poster

Our Alzheimer's disease poster summarizes the structural and functional changes observed in the progression of this neurodegenerative disease. Request copy or view PDF today.

divider line

Peripheral Sensitization

Written by Grant D. Nicol and Michael R. Vasko

Pain Life Science Poster

Our Peripheral Sensitization poster gives a summary of the excitatory and inhibitory signaling pathways involved in modulation of peripheral sensitization. Request copy or view PDF today.

divider line

Learning and Memory

Written by Clea Warburton and Zafar Bashir

Learning & Memory Life Science Poster

Our Learning and Memory poster gives an overview of the cellular mechanisms underlying recognition memory and its links to long-term depression. Request copy or view PDF today.

divider line

Bio-Techne Events

Pharmacology 2016

Pharmacology 2016

December 13 - 15, 2016

London, UK

Booth: 7