Oxyntomodulin

Cat. No. 2094

Oxyntomodulin His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala

Price and Availability

For Oxyntomodulin pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Names: Glucagon (1-37), Enteroglucagon

Biological Activity

Endogenous glucagon-like peptide that modulates feeding and metabolism; secreted by intestinal L-cells. Increases cAMP production and inhibits gastric acid secretion in rat stomach. Also inhibits intestinal glucose absorption. Reduces fasting ghrelin levels following peripheral administration and reduces food intake and weight gain in rats following central or peripheral administration in vivo.

Technical Data

M.Wt:
4421.86
Formula:
C192H295N59O60S
Sequence:
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
62340-29-8

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Dakin et al (2004) Peripheral oxyntomodulin reduces food intake and body weight gain in rats. Endocrinology 145 2687. PMID: 15001546.

Stanley et al (2004) Gastrointestinal satiety signals III. Glucagon-like peptide 1, oxyntomodulin, peptide YY, and pancreatic polypeptide. Am.J.Physiol.Gastrointest.Liver Physiol. 286 G693. PMID: 15068960.

Stumpel et al (1997) A new role for enteric glucagon-37: acute stimulation of glucose absorption in rat small intestine. FEBS Lett. 410 515. PMID: 9237694.

Bataille et al (1981) Bioactive enteroglucagon (oxyntomodulin): present knowledge on its chemical structure and its biological activities. Peptides 2 41. PMID: 6283496.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Oxyntomodulin from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Oxyntomodulin, supplier, Endogenous, gut, peptide, modulates, feeding, metabolism, GLP1, Receptors, Glucagon-Like, Peptide, 1, Glucagon, Tocris Bioscience, Glucagon-Like Peptide 1 Receptor products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Life Science Poster

Our Gut Hormones and the Regulation of Appetite poster gives an overview of the neuropeptide modulators and gut hormones that influence appetite. Request copy today.

divider line

New Products in this Area

[Pro3]-GIP (Rat)

High affinity rat GIP receptor partial agonist

[Pro3]-GIP (Mouse)

GIP receptor antagonist

Sign-up for new product e-alerts
divider line

Bio-Techne Events

IVBM 2016

IVBM 2016

October 30 - November 3, 2016

Boston, MA, USA

Booth: 2