Glucagon-like peptide 1 (7-36) amide (human, rat)

Cat. No. 2082

Glucagon-like peptide 1 (7-36) amide (human, rat) His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Price and Availability

For Glucagon-like peptide 1 (7-36) amide (human, rat) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: GLP-1 (7-36) amide

Biological Activity

Potent glucose-dependent insulinotropic peptide produced by post-translational processing of proglucagon in intestinal L-cells. Displays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells (Kd = 204 pM). Stimulates insulin gene transcription and secretion in pancreatic β-cells. Displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration.

Technical Data

M.Wt:
3297.67
Formula:
C149H226N40O45
Sequence:
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

(Modifications: Arg-30 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
107444-51-9

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Perry et al (2002) Protection and reversal of excitotoxic neuronal damage by glucagon-like peptide-1 and exendin-4. J.Pharmacol.Exp.Ther. 302 881. PMID: 12183643.

Perfetti and Merkel (2000) Glucagon-like peptide-1: a major regulator of pancreatic β-cell function. Eur.J.Endocrinol. 143 717. PMID: 11124853.

Turton et al (1996) A role for glucagon-like peptide-1 in the central regulation of feeding. Nature 379 69. PMID: 8538742.

Goke and Conlon (1988) Receptors for glucagon-like peptide-1(7-37) amide on rat insulinoma-derived cells. J.Endocrinol. 116 357. PMID: 2832504.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Glucagon-like peptide 1 (7-36) amide (human, rat) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Glucagon-like peptide 1 (7-36) amide (human, rat), supplier, Potent, insulinotropic, peptide, GLP-1, Receptors, Glucagon-Like, Peptide, 1, Glucagon-like, peptide1, (7-36), amide, (human, rat), GLP1(7-36), Tocris Bioscience, Glucagon-Like Peptide 1 Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs Request copy or view PDF today.

divider line

Appetite Modulation

Written by S. Tucci et al

Peptides Involved in Appetite Modulation Scientific Review

Our Peptides Involved in Appetite Modulation review gives an overview of the peptides implicated in appetite regulation and energy homeostasis. View PDF today.

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Life Science Poster

Our Gut Hormones and the Regulation of Appetite poster gives an overview of the neuropeptide modulators and gut hormones that influence appetite. Request copy today.

divider line

New Products in this Area

[Pro3]-GIP (Rat)

High affinity rat GIP receptor partial agonist

[Pro3]-GIP (Mouse)

GIP receptor antagonist

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.