Parathyroid hormone (1-34) (human)

Cat. No. 3011

Parathyroid hormone (1-34) (human) Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe

Price and Availability

For Parathyroid hormone (1-34) (human) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Names: PTH 1-34, hPTH (1-34), Teriparatide

Biological Activity

Human parathyroid hormone (hPTH) peptide fragment; contains the 34 N-terminal residues of hPTH. Agonist at parathyroid 1 (PTH1) and parathyroid 2 (PTH2) receptors.

Technical Data

M.Wt:
4117.75
Formula:
C181H291N55O51S2
Sequence:
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Solubility:
Soluble to 0.40 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
52232-67-4

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

Manabe et al (2007) Human parathyroid hormone (1-34) accelerates natural fracture healing process in the femoral osteotomy model of cynomolgus monkeys. Bone 40 1475. PMID: 17369013.

Dobnig and Turner (1997) The effects of programmed administration of human parathyroid hormone fragment (1-34) on bone histomorphometry and serum chemistry in rats. Endocrinology 138 4607. PMID: 9348185.

Niall et al (1974) The amino acid sequence of the amino-terminal 37 residues of human parathyroid hormone. Proc.Natl.Acad.Sci. 71 384.

If you know of a relevant reference for this product please let us know.

Citations are publications that use Tocris products.

Do you know of a great paper that uses Parathyroid hormone (1-34) (human) from Tocris? If so please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Parathyroid hormone (1-34) (human), supplier, Parathyroid, hormone, PTH, receptors, agonists, PTH134, 1-34, teriparatide, Tocris Bioscience, Parathyroid Hormone Receptor Agonist products

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptors Product Listing

Our Peptide Hormone Receptors Listing highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

GPCR Product Listing

GPCR Product Listing

Highlights over 450 products for GPCRs Request copy or view PDF today.

divider line

New Products in this Area

MSG 606

Potent human MC1 receptor antagonist; also MC3 and MC5 partial agonist

Neuropeptide S (Mouse)

Potent endogenous neuropeptide S receptor (NPSR) agonist

ML 382

MrgX1 (SNSR4) positive allosteric modulator

K-(D-1-Nal)-FwLL-NH2

High affinity and potent ghrelin receptor inverse agonist

Neuropeptide S (Rat)

Potent endogenous neuropeptide S receptor agonist

Neuropeptide S (human)

Potent endogenous neuropeptide S receptor agonist

Sign-up for new product e-alerts
divider line

LinkedIn Updates

Follow Tocris on LinkedIn

Follow us on LinkedIn!

Visit our LinkedIn page for the latest Tocris news, events and updates.