R&D Systems Inc. Tocris Bioscience Boston Biochem

Peptide YY (3-36)

Cat. No. 1618

Peptide YY (3-36) Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

Price and Availability

For Peptide YY (3-36) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: PYY 3-36

Biological Activity

Y2 selective agonist. IC50 values are 0.11 and 1050 nM for inhibition of 125I-PYY binding to Y2 and Y1 receptors respectively. Inhibits food intake and reduces weight gain in vivo. Brain penetrant.

Technical Data

M.Wt:
3980.4
Formula:
C176H272N52O54
Sequence:
AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY

(Modifications: Tyr-34 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
126339-09-1

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Keire et al (2000) Primary structures of PYY, [Pro34]PYY and PYY-(3-36) confer different conformations and receptor selectivity. Am.J.Physiol.Gastrointest.Liver Physiol. 279 G126. PMID: 10898754.

Batterham et al (2002) Gut hormone PYY3-36 physiologically inhibits food intake. Nature 418 650. PMID: 12167864.

Nonaka et al (2003) Characterization of blood-brain barrier permeability to PYY3-36 in the mouse. J.Pharmacol.Exp.Ther. 306 948. PMID: 12750431.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

Keywords: Peptide YY (3-36), supplier, Selective, Y2, receptor, agonists, Neuropeptide, Y, Receptors, NPY, PeptideYY, (3-36), PYY336, neuropeptides

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptor Product Listing

Highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

Appetite Modulation

Peptides Involved in Appetite Modulation Review

Written by Sonia A. Tucci, Lynsay Kobelis & Tim Kirkham. Request a copy or view PDF today.

divider line

Regulation of Vascular Reactivity by GPCRs

Written by J.J. Maguire and A.P. Davenport

Cardiovascular Poster

'Regulation of Vascular Reactivity by G-protein-coupled Receptors' summarizes the key GPCRs regulating vascular reactivity.

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Poster

'Gut Hormones and the Regulation of Appetite' summarizes the neuropeptide modulators and gut hormones that influence appetite

divider line

7-TM Receptor Signaling

Written by T. Kenakin et al

7-TM Poster

'Seven Transmembrane Receptor Signaling' highlights the multiple behaviors of 7-TMs including G-protein-dependent and -independent signaling as well as the concept of collateral efficacy

divider line

New Product Guide

NPG

Highlights over 130 new products added in the second half of 2013. Request a copy or view PDF today.

divider line

New Products in this Area

ANQ 11125

Selective motilin receptor antagonist

AdipoRon hydrochloride

Orally active AdipoR1 and AdipoR2 agonist; antidiabetic

PG 931

Potent and selective MC4 receptor agonist

CYM 50769

Novel non-peptide NPBWR1 antagonist

Pramlintide

Synthetic version of amylin (Cat. No. 3418)

Sign-up for new product e-alerts
divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.