R&D Systems Inc. Tocris Bioscience Boston Biochem

ProTx II

Cat. No. 4023

ProTx II Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Met-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Lys-Leu-Trp

Price and Availability

For ProTx II pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent and selective NaV1.7 channel blocker (IC50 = 0.3 nM). Shifts activation gating positively and decreases current magnitude. Displays 100-fold selectivity over other sodium channel subtypes.

Technical Data

M.Wt:
3826.59
Formula:
C168H250N46O41S8
Sequence:
YCQKWMWTCDSERKCCEGMVCRLWCKKKLW­

(Modifications: Disulfide bridge: 2-16, 9-21, 15-25)

Solubility:
Soluble to 0.10 mg/ml in 4:1 Acetonitrile : water
Storage:
Store at -20°C
CAS No:
484598-36-9

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Smith et al (2007) Molecular interactions of the gating modifier toxin ProTx-II with NaV 1.5: implied existence of a novel toxin binding site coupled to activation. J.Biol.Chem. 282 12687. PMID: 17339321.

Edgerton et al (2008) Evidence for multiple effects of ProTxII on activation gating in NaV 1.5. Toxicon. 52 489. PMID: 18657562.

Schmalhofer et al (2008) ProTx-II, a selective inhibitor of NaV 1.7 sodium channels, blocks action potential propagation in nociceptors. Mol.Pharmacol. 74 1476. PMID: 18728100.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

Keywords: ProTx II, supplier, toxins, voltage, gated, sodium, Na+, channels, NaV1.7, potent, selective, blockers

Quick Order

Find multiple products by catalog number

divider line

Pain Research Guide

Reserve your free copy

Pain Research Guide

Highlights over 280 products for Pain research. Reserve copy

divider line

Cancer Research Guide

Request your free copy

Cancer Research Guide

Highlights over 350 products for cancer research. Request a copy or view PDF today.

divider line

Calcium Imbalance and Neuroprotective Targets

Written by E. Besancon et al

Neuroprotection Poster

'Calcium Imbalance and Neuro-protective Targets in Cerebral Ischemia & Brain Injury' highlights the key targets involved in stroke, trauma and neurodegeneration.

divider line

New Product Guide

NPG

Highlights over 130 new products added in 2012. Request a copy or view PDF today.

divider line

New Products in this Area

Huwentoxin IV

Selective NaV 1.7 channel blocker

Sign-up for new product e-alerts
divider line

Tocris Events

Win a Kindle

11th Congress of the French Neuroscience Society

11th Congress of the French Neuroscience Society

May 21 - 24, 2013

Lyon, France

Booth Number: 32