Home » Product Type » Peptides » 7-TM Receptors » Peptide Receptors » PACAP Receptors » PACAP 6-38

PACAP 6-38

Cat. No. 3236

Price and Availability

For PACAP 6-38 pricing & availability please select your country from the drop down menu:
Submit

By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)₁ antagonist (IC₅₀ = 2 nM). Inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (K_i = 1.5 nM). Antitumor activity in vivo.

Technical Data

M.Wt:

4024.78

Formula:

C₁₈₂H₃₀₀N₅₆O₄₅S

Sequence:

FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK

(Modifications: Lys-33 = C-terminal amide)

Solubility:

Soluble to 1 mg/ml in 15% acetonitrile / water

Storage:

Desiccate at -20°C

CAS No:

143748-18-9

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Resources

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch

Safety Data Sheet: View Safety Data Sheet

References

Robberecht et al (1992) Structural requirements for the occupancy of pituitary adenylate-cyclase-activating-peptide (PACAP) receptors and adenylate cyclase activation in human neuroblastoma NB-OK-1 cell membranes. Discovery of PACAP(6-38) as a potent antagonist. Eur.J.Biochem. 207 239. PMID: 1321043.

Leyton et al (1998) PACAP(6-38) inhibits growth of prostate cancer cells. Cancer Lett. 125 131. PMID: 9566707.

Kojro et al (2006) The neuropeptide PACAP promotes a-secretase pathway for processing Alzheimer amyloid precursor protein. FASEB J. 20 512. PMID: 16401644.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

PACAP Receptors

Peptide Receptors

Keywords: PACAP 6-38, supplier, Potent, PAC1, receptors, antagonists, Pituitary, Adenylate, Cyclase, Activating, Peptide, PACAP638

Quick Order

Find multiple products by catalog number

7-TM Receptor Signaling

Written by T. Kenakin et al

'Seven Transmembrane Receptor Signaling' highlights the multiple behaviors of 7-TMs including G-protein-dependent and -independent signaling as well as the concept of collateral efficacy