Echistatin, α1 isoform

Cat No. 3202

Echistatin, a1 isoform Glu-Cys-Glu-Ser-Gly-Pro-Cys-Cys-Arg-Asn-Cys-Lys-Phe-Leu-Lys-Glu-Gly-Thr-Ile-Cys-Lys-Arg-Ala-Arg-Gly-Asp-Asp-Met-Asp-Asp-Tyr-Cys-Asn-Gly-Lys-Thr-Cys-Asp-Cys-Pro-Arg-Asn-Pro-His-Lys-Gly-Pro-Ala-Thr

Price and Availability

For Echistatin, α1 isoform pricing & availability please select your country from the drop down menu:
Submit

Biological Activity

Potent irreversible αVβ3 integrin antagonist (Ki = 0.27 nM). Disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC50 = 0.1 nM). Prevents ADP-induced platelet aggregation via inhibition of glycoprotein IIb/IIIa (GpIIb/IIIa, αIIbβ3) receptors (IC50 = 30 nM) in vitro.

Technical Data

M.Wt:
5417.1
Formula:
C217H341N71O74S9
Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCN GKTCDCPRNPHKGPAT

(Modifications: Disulfide bridge between 2 - 11, 7 - 32, 8 - 37, 20 - 39)

Storage:
Store at -20°C
CAS No:
[154303-05-6]

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis and MSDS.

Certificate of Analysis / MSDS

Certificate of Analysis: View current batch
For specific/earlier batch please select:  
Material Safety Data Sheet: View current batch
For specific/earlier batch please select:  

References

Musial et al (1990) Inhibition of platelet adhesion to surfaces of extracorporeal circuits by disintegrins RGD-containing peptides from viper venoms. Circulation 82 261. Sato et al (1990) Echistatin is a potent inhibitor of bone resorption in culture. J.Cell.Biol. 111 1713. Kumar et al (1997) Biochemical characteriation of the binding of echistatin to integrin αVβ3 receptor. J.Pharmacol.Exp.Ther. 283 843.

If you know of a useful citation for this product please let us know.

Keywords: Echistatin, a1 isoform, αVβ3, alphaVβ3, beta3, glycoprotein, IIb/IIIa, αIIbβ3, alphaIIbβ3, beta3, inhibitors, Integrin, Receptors, Adhesion, Molecules, Echistatin, alpha1, isoform, Echistatina1, isoform

Buy Now / Print Quote

Find multiple products by catalog number


divider line

Print Quote Facility

Order via your purchasing department

Print Quote Facility

It's now even easier to place orders via your purchasing department.

Simply add a product to your cart & click on the "Print Quote" button.

more
divider line

Immunology Guide

Immunology Research Guide

Highlights over 150 products for immunology research. Request a copy or view PDF today.

request
divider line

New Products in this Area

BIO 1211

Selective α4β1 (VLA-4) inhibitor

Sign-up for new product e-alerts
divider line

RSS News Feed

Find out about new products as soon as they go live!

Get the Tocris RSS feed

Click on the orange RSS button to read more about our RSS feed and actively opt in.

more