R&D Systems Inc. Tocris Bioscience Boston Biochem

Echistatin, α1 isoform

Cat. No. 3202

Echistatin, a1 isoform Glu-Cys-Glu-Ser-Gly-Pro-Cys-Cys-Arg-Asn-Cys-Lys-Phe-Leu-Lys-Glu-Gly-Thr-Ile-Cys-Lys-Arg-Ala-Arg-Gly-Asp-Asp-Met-Asp-Asp-Tyr-Cys-Asn-Gly-Lys-Thr-Cys-Asp-Cys-Pro-Arg-Asn-Pro-His-Lys-Gly-Pro-Ala-Thr

Price and Availability

For Echistatin, α1 isoform pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent irreversible αVβ3 integrin antagonist (Ki = 0.27 nM). Disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC50 = 0.1 nM). Prevents ADP-induced platelet aggregation via inhibition of glycoprotein IIb/IIIa (GpIIb/IIIa, αIIbβ3) receptors (IC50 = 30 nM) in vitro.

Technical Data

M.Wt:
5417.1
Formula:
C217H341N71O74S9
Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

(Modifications: Disulfide bridge between 2 - 11, 7 - 32, 8 - 37, 20 - 39)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
154303-05-6

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Musial et al (1990) Inhibition of platelet adhesion to surfaces of extracorporeal circuits by disintegrins RGD-containing peptides from viper venoms. Circulation 82 261. PMID: 2364514.

Sato et al (1990) Echistatin is a potent inhibitor of bone resorption in culture. J.Cell.Biol. 111 1713. PMID: 2211834.

Kumar et al (1997) Biochemical characteriation of the binding of echistatin to integrin αVβ3 receptor. J.Pharmacol.Exp.Ther. 283 843. PMID: 9353406.

If you know of a relevant citation for this product please let us know.

Keywords: Echistatin, a1 isoform, supplier, αVβ3, alphaVβ3, beta3, glycoprotein, IIb/IIIa, αIIbβ3, alphaIIbβ3, inhibitors, Integrin, Receptors, Adhesion, Molecules, Echistatin, alpha1, isoform, Echistatina1

Quick Order

Find multiple products by catalog number

divider line

Immunology Guide

Immunology Research Guide

Highlights over 150 products for immunology research. Request a copy or view PDF today.

divider line

New Product Guide

NPG

Highlights over 130 new products added in the second half of 2013. Request a copy or view PDF today.

divider line

New Products in this Area

BIO 5192

Highly potent and selective inhibitor of integrin α4β1

CU CPT 4a

Selective TLR3 antagonist

Sign-up for new product e-alerts
divider line

Bio-Techne Events

Federation of European Physiologists Meeting 2014

Federation of European Physiologists Meeting 2014

August 27 - 30, 2014

Budapest, Hungary