R&D Systems Inc. Tocris Bioscience Boston Biochem

Echistatin, α1 isoform

Cat. No. 3202

Echistatin, a1 isoform Glu-Cys-Glu-Ser-Gly-Pro-Cys-Cys-Arg-Asn-Cys-Lys-Phe-Leu-Lys-Glu-Gly-Thr-Ile-Cys-Lys-Arg-Ala-Arg-Gly-Asp-Asp-Met-Asp-Asp-Tyr-Cys-Asn-Gly-Lys-Thr-Cys-Asp-Cys-Pro-Arg-Asn-Pro-His-Lys-Gly-Pro-Ala-Thr

Price and Availability

For Echistatin, α1 isoform pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Potent irreversible αVβ3 integrin antagonist (Ki = 0.27 nM). Disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC50 = 0.1 nM). Prevents ADP-induced platelet aggregation via inhibition of glycoprotein IIb/IIIa (GpIIb/IIIa, αIIbβ3) receptors (IC50 = 30 nM) in vitro.

Technical Data

M.Wt:
5417.1
Formula:
C217H341N71O74S9
Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

(Modifications: Disulfide bridge between 2 - 11, 7 - 32, 8 - 37, 20 - 39)

Solubility:
Soluble to 1 mg/ml in water
Storage:
Store at -20°C
CAS No:
154303-05-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Musial et al (1990) Inhibition of platelet adhesion to surfaces of extracorporeal circuits by disintegrins RGD-containing peptides from viper venoms. Circulation 82 261. PMID: 2364514.

Sato et al (1990) Echistatin is a potent inhibitor of bone resorption in culture. J.Cell.Biol. 111 1713. PMID: 2211834.

Kumar et al (1997) Biochemical characteriation of the binding of echistatin to integrin αVβ3 receptor. J.Pharmacol.Exp.Ther. 283 843. PMID: 9353406.

If you know of a relevant citation for this product please let us know.

Keywords: Echistatin, a1 isoform, supplier, αVβ3, alphaVβ3, beta3, glycoprotein, IIb/IIIa, αIIbβ3, alphaIIbβ3, inhibitors, Integrin, Receptors, Adhesion, Molecules, Echistatin, alpha1, isoform, Echistatina1

Quick Order

Find multiple products by catalog number

divider line

Immunology Guide

Immunology Research Guide

Highlights over 150 products for immunology research. Request a copy or view PDF today.

divider line

New Product Guide

NPG

Highlights 150 new products added in the second half of 2014. View PDF today.

divider line

New Products in this Area

R 7050

Inhibitor of TNF-α receptor 1 signaling

C34

TLR4 inhibitor

BIRT 377

Potent negative allosteric modulator of LFA-1

BTT 3033

Selective inhibitor of integrin α2β1

Sign-up for new product e-alerts
divider line

Bio-Techne Events

AACR 2015

AACR 2015

April 18 - 22, 2015

Philadelphia, PA

Booth: 2135