Pharmacology
All Targets
7-TM Receptors
Ion Channels
Nuclear Receptors
Enzyme-Linked Receptors
Transporters
Enzymes
Other Pharmacology
Cellular Processes
Angiogenesis
Apoptosis
Cell Cycle
Cell Metabolism
Cytoskeleton & Motor Proteins
ECM & Adhesion Molecules
Signal Transduction
Stem Cells
Product Type
All Products
New Products
Small Molecules
Peptides
Antibodies
Jena Bioscience
Controlled Substances
Toxins
Caged Compounds
Fluorescent Probes
Screening Libraries
Ligand Sets
Other Product Types
Research Area
Cancer
Cardiovascular Disease
Endocrinology
Immunology
Metabolic Disease
Neurological Disease
Pain & Inflammation
Respiratory Disease
Echistatin, α1 isoformCat No. 3202 |
Price and Availability |
Biological Activity
Potent irreversible αVβ3 integrin antagonist (Ki = 0.27 nM). Disrupts attachment of osteoclasts to bone and inhibits bone reabsorption (IC50 = 0.1 nM). Prevents ADP-induced platelet aggregation via inhibition of glycoprotein IIb/IIIa (GpIIb/IIIa, αIIbβ3) receptors (IC50 = 30 nM) in vitro.Technical Data
M.Wt:5417.1
Formula:C217H341N71O74S9
Sequence:ECESGPCCRNCKFLKEGTICKRARGDDMDDYCN
GKTCDCPRNPHKGPAT
Storage:(Modifications: Disulfide bridge between 2 - 11, 7 - 32, 8 - 37, 20 - 39)
Store at -20°C
CAS No:[154303-05-6]
The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis and MSDS.
Certificate of Analysis / MSDS
Certificate of Analysis: View current batch
For specific/earlier batch please select:
Material Safety Data Sheet: View current batch
For specific/earlier batch please select:
References
Musial et al (1990) Inhibition of platelet adhesion to surfaces of extracorporeal circuits by disintegrins RGD-containing peptides from viper venoms. Circulation 82 261. Sato et al (1990) Echistatin is a potent inhibitor of bone resorption in culture. J.Cell.Biol. 111 1713. Kumar et al (1997) Biochemical characteriation of the binding of echistatin to integrin αVβ3 receptor. J.Pharmacol.Exp.Ther. 283 843.If you know of a useful citation for this product please let us know.
View Related Products by Target
Keywords: Echistatin, a1 isoform, αVβ3, alphaVβ3, beta3, glycoprotein, IIb/IIIa, αIIbβ3, alphaIIbβ3, beta3, inhibitors, Integrin, Receptors, Adhesion, Molecules, Echistatin, alpha1, isoform, Echistatina1, isoform
Buy Now / Print Quote
Find multiple products by catalog number
New Products in this Area
BIO 1211
Selective α4β1 (VLA-4) inhibitor
Sign-up for new product e-alerts
RSS News Feed
Find out about new products as soon as they go live!
Click on the orange RSS button to read more about our RSS feed and actively opt in.


