R&D Systems Inc. Tocris Bioscience Boston Biochem

Amyloid β-Peptide (1-40) (human)

Cat. No. 1191

Amyloid b-Peptide (1-40) (human) Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val

Price and Availability

For Amyloid β-Peptide (1-40) (human) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Peptide found in plaques in the brains of patients with Alzheimer's disease. Shown to have both neurotrophic and neurotoxic effects.

Technical Data

M.Wt:
4329.86
Formula:
C194H295N53O58S
Sequence:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGA­IIGLMVGGVV
Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
131438-79-4

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Yankner et al (1990) Neurotrophic and neurotoxic effects of amyloid β protein: reversal by tachykinin neuropeptides. Science 250 279. PMID: 2218531.

Kowalska and Badellino (1994) β-Amyloid protein induces platelet aggregation and supports platelet adhesion. Biochem.Biophys.Res.Commun. 205 1829. PMID: 7811271.

Cleary et al (1995) Beta-amyloid(1-40) effects on behavior and memory. Brain Res. 682 69. PMID: 7552329.

Miguel-Hidalgo and Cacabelos (1998) Beta-amyloid(1-40)-induced neurodegeneration in the rat hippocampal neurons of the CA1 subfield. Acta Neuropathol. 95 455. PMID: 9600591.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

Keywords: Amyloid b-Peptide (1-40) (human), supplier, Amyloid, β-protein, beta-protein, fragment, Precursor, Protein, APP, Secretase, β-peptide, beta-peptides, b-peptides, b-amyloid, β-Amyloid, beta-Amyloid, amyloid, beta-peptide, (1-40), (human)

Quick Order

Find multiple products by catalog number

divider line

The Neurobiology of Alzheimer's Disease

Written by Alan Palmer

Alzheimer's Poster

'The Neurobiology of Alzheimer's Disease' summarizes structural and functional changes observed in the progression of AD.

divider line

New Product Guide

NPG

Highlights over 130 new products added in 2012. Request a copy or view PDF today.

divider line

New Products in this Area

Capecitabine

Prodrug of 5-Fluorouracil (Cat. No. 3257). Inhibits DNA synthesis

8-Chloroadenosine

Cytotoxic nucleoside analog; inhibits RNA synthesis

Sign-up for new product e-alerts
divider line

Twitter Updates

Follow @Tocris on Twitter

Follow us on Twitter!

Tocris is now actively tweeting. For regular updates on news, events and special offers, follow @Tocris on Twitter.