Home » Product Type » Peptides » 7-TM Receptors » Peptide Receptors » PACAP Receptors » PACAP 1-38

PACAP 1-38

Cat. No. 1186

Price and Availability

For PACAP 1-38 pricing & availability please select your country from the drop down menu:
Submit

By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: Pituitary Adenylate Cyclase-Activating Polypeptide 1-38

Biological Activity

Endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP) but with a greater potency for stimulation of adenylyl cyclase.

Technical Data

M.Wt:

4535

Formula:

C₂₀₃H₃₃₁N₆₃O₅₃S

Sequence:

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK

(Modifications: Lys-38 = C-terminal amide)

Solubility:

Soluble to 0.90 mg/ml in water

Storage:

Desiccate at -20°C

CAS No:

137061-48-4

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Resources

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch

Select another batch:

Safety Data Sheet: View Safety Data Sheet

References

Rawlings et al (1994) Pituitary adenylate cyclase-activating polypeptide increase [Ca²⁺]i in rat gonadotrophs through an inositol trisphosphate-dependent mechanism. J.Biol.Chem. 269 5680. PMID: 7907085.

Lazarovici et al (1998) The 38-amino-acid form of pituitary adenylate cyclase-activating polypeptide induces neurite outgrowth in PC12 cells that is dependent on protein kinase C and extracellular signal-regulated kinase but not on protein kinase A, nerve growth factor receptor tyrosine kinase, p21^ras G protein, and pp60^c-src cytoplasmic tyrosine kinase. Mol.Pharmacol. 54 547. PMID: 9730914.

Michel et al (1998) XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 50 143. PMID: 9549761.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

Adenylyl Cyclase Cyclases Inositol and cAMP Signaling

PACAP Receptors Peptide Receptors

Keywords: PACAP 1-38, supplier, Potently, stimulates, adenylyl, cyclases, stimulator, adenylate, Inositol, cAMP, Signaling, Signalling, Pituitary, Adenylate, Activating, Peptide, Receptors, PAC1, PACAP138

Quick Order

Find multiple products by catalog number

7-TM Receptor Signaling

Written by T. Kenakin et al

'Seven Transmembrane Receptor Signaling' highlights the multiple behaviors of 7-TMs including G-protein-dependent and -independent signaling as well as the concept of collateral efficacy