Apelin-36 (rat, mouse)

Cat. No. 2427

Apelin-36 (rat, mouse) Leu-Val-Lys-Pro-Arg-Thr-Ser-Arg-Thr-Gly-Pro-Gly-Ala-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe

Price and Availability

For Apelin-36 (rat, mouse) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Endogenous APJ receptor agonist that is secreted by adipocytes. Binds with high affinity to APJ receptors (IC50 = 5.4 nM) and potently inhibits cAMP production in vitro (EC50 = 0.52 nM). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.

Technical Data

M.Wt:
4200.93
Formula:
C185H304N68O43S
Sequence:
LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
Solubility:
Soluble to 1.60 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
230299-95-3

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Tatemoto et al (1998) Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem.Biophys.Res.Comm. 251 471.

Zou et al (2000) Apelin peptides block the entry of human immunodeficiency virus (HIV). FEBS Lett. 473 15. PMID: 10802050.

Kawamata et al (2001) Molecular properties of apelin: tissue distribution and receptor binding. Biochim.Biophys.Acta 1538 162. PMID: 11336787.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

View Related Products by Product Action

Keywords: Apelin-36 (rat, mouse), supplier, Endogenous, APJ, receptors, agonists, Apelin, adipokines, Tocris Bioscience, Apelin Receptor Agonists

Quick Order

Find multiple products by catalog number

divider line

New Product Guide

NPG

Highlights 130 new products added in the first half of 2015. View PDF today.

divider line

Bio-Techne Events

TOX EXPO

The Society of Toxicology's 55th Annual Meeting and ToxExpo

March 14 - 16, 2016

New Orleans, LA, USA