Home » Product Type » Peptides » 7-TM Receptors » Peptide Receptors » Apelin Receptor » Apelin-36 (human)

Apelin-36 (human)

Cat. No. 2426

Price and Availability

For Apelin-36 (human) pricing & availability please select your country from the drop down menu:
Submit

By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Endogenous APJ receptor agonist (EC₅₀ = 20 nM) that is secreted by adipocytes. Binds with high affinity to human APJ receptors expressed in HEK 293 cells (pIC₅₀= 8.61). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.

Technical Data

M.Wt:

4195.87

Formula:

C₁₈₄H₂₉₇N₆₉O₄₃S

Sequence:

LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

Solubility:

Soluble to 1 mg/ml in water

Storage:

Desiccate at -20°C

CAS No:

252642-12-9

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Resources

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch

Select another batch:

Safety Data Sheet: View Safety Data Sheet

References

Tatemoto et al (1998) Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem.Biophys.Res.Comm. 251 471.

Zou et al (2000) Apelin peptides block the entry of human immunodeficiency virus (HIV). FEBS Lett. 473 15. PMID: 10802050.

Medhurst et al (2003) Pharmacological and immunohistochemical characterization of the APJ receptor and its endogenous ligand apelin. J.Neurochem. 84 1162. PMID: 12603839.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

Apelin Receptor

Peptide Receptors

Keywords: Apelin-36 (human), supplier, Endogenous, APJ, receptors, agonists, Apelin, adipokines

Quick Order

Find multiple products by catalog number

Cardiovascular Guide

Request your free copy

Highlights over 250 products for cardiovascular research. Request a copy or view PDF today.

7-TM Receptor Signaling

Written by T. Kenakin et al

'Seven Transmembrane Receptor Signaling' highlights the multiple behaviors of 7-TMs including G-protein-dependent and -independent signaling as well as the concept of collateral efficacy