R&D Systems Inc. Tocris Bioscience Boston Biochem

Apelin-36 (human)

Cat. No. 2426

Apelin-36 (human) Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe

Price and Availability

For Apelin-36 (human) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Biological Activity

Endogenous APJ receptor agonist (EC50 = 20 nM) that is secreted by adipocytes. Binds with high affinity to human APJ receptors expressed in HEK 293 cells (pIC50= 8.61). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.

Technical Data

M.Wt:
4195.87
Formula:
C184H297N69O43S
Sequence:
LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Solubility:
Soluble to 1 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
252642-12-9

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Tatemoto et al (1998) Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem.Biophys.Res.Comm. 251 471.

Zou et al (2000) Apelin peptides block the entry of human immunodeficiency virus (HIV). FEBS Lett. 473 15. PMID: 10802050.

Medhurst et al (2003) Pharmacological and immunohistochemical characterization of the APJ receptor and its endogenous ligand apelin. J.Neurochem. 84 1162. PMID: 12603839.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

Keywords: Apelin-36 (human), supplier, Endogenous, APJ, receptors, agonists, Apelin, adipokines

Quick Order

Find multiple products by catalog number

divider line

Cardiovascular Research Product Guide

Cardiovascular Research Guide

Highlights over 250 products for cardiovascular research. Request a copy or view PDF today.

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptor Product Listing

Highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

Regulation of Vascular Reactivity by GPCRs

Written by J.J. Maguire and A.P. Davenport

Cardiovascular Poster

'Regulation of Vascular Reactivity by G-protein-coupled Receptors' summarizes the key GPCRs regulating vascular reactivity.

divider line

New Product Guide

NPG

Highlights 130 new products added in the first half of 2015. View PDF today.

divider line

New Products in this Area

Obestatin (human)

Endogenous reported anorexigenic peptide

TC NTR1 17

Selective non-peptide NTS1 agonist

ML 354

Selective PAR4 antagonist

GW 438014A

NPY Y5 receptor antagonist

TC-FPR 43

Potent FPR2 agonist

TC-G 1003

High affinity somatostatin sst2 receptor agonist

Kisspeptin 10 (dog)

Endogenous ligand for canine kisspeptin receptor

Sign-up for new product e-alerts
divider line

Bio-Techne Events

IBRO 2015

IBRO 2015

July 7 - 11, 2015

Rio de Janeiro, Brazil

Booth: B21