R&D Systems Inc. Tocris Bioscience Boston Biochem

Neuropeptide Y (human, rat)

Cat. No. 1153

Neuropeptide Y (human, rat) Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2

Price and Availability

For Neuropeptide Y (human, rat) pricing & availability please select your country from the drop down menu:
Submit
By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: NPY (human, rat)

Biological Activity

Widely distributed endogenous neuropeptide involved in the control of food intake, sexual behavior and blood pressure.

Technical Data

M.Wt:
4271.7
Formula:
C189H285N55O57S
Sequence:
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

(Modifications: Tyr-36 = C-terminal amide)

Solubility:
Soluble to 1.50 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
90880-35-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
All Tocris products are intended for laboratory research use only.

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch
Select another batch:
Safety Data Sheet: View Safety Data Sheet

References

Minth et al (1984) Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine. Proc.Natl.Acad.Sci.U.S.A. 81 4577. PMID: 6589611.

Allen et al (1987) Molecular structure of mammalian neuropeptide Y: analysis by molecular cloning and computer-aided comparison with crystal structure of avian homologue. Proc.Natl.Acad.Sci.U.S.A. 84 2532. PMID: 3031687.

Michel et al (1998) XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 50 143. PMID: 9549761.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

Keywords: Neuropeptide Y (human, rat), supplier, Influences, feeding, sexual, behavior, Neuropeptide, Y, Receptors, NPY, agonists, NeuropeptideY, (human), neuropeptides, Neuropeptide, Y, (human,, rat)

Quick Order

Find multiple products by catalog number

divider line

Peptide Hormone Receptors Product Listing

Peptide Hormone Receptor Product Listing

Highlights over 200 products for peptide hormone receptors. Request copy or view PDF today.

divider line

Appetite Modulation

Peptides Involved in Appetite Modulation Review

Written by Sonia A. Tucci, Lynsay Kobelis & Tim Kirkham. Request a copy or view PDF today.

divider line

Regulation of Vascular Reactivity by GPCRs

Written by J.J. Maguire and A.P. Davenport

Cardiovascular Poster

'Regulation of Vascular Reactivity by G-protein-coupled Receptors' summarizes the key GPCRs regulating vascular reactivity.

divider line

Gut Hormones and the Regulation of Appetite

Written by V.J. Taylor et al

Gut Hormones Poster

'Gut Hormones and the Regulation of Appetite' summarizes the neuropeptide modulators and gut hormones that influence appetite

divider line

New Product Guide

NPG

Highlights 130 new products added in the first half of 2015. View PDF today.

divider line

New Products in this Area

DPC AJ1951

Potent parathyroid hormone (PTH) receptor agonist

Obestatin (human)

Endogenous reported anorexigenic peptide

TC NTR1 17

Selective non-peptide NTS1 agonist

ML 354

Selective PAR4 antagonist

GW 438014A

NPY Y5 receptor antagonist

TC-FPR 43

Potent FPR2 agonist

TC-G 1003

High affinity somatostatin sst2 receptor agonist

Sign-up for new product e-alerts
divider line

Bio-Techne Events

EMBO 2015

The 6th EMBO Meeting 2015

September 5 - 8, 2015

Birmingham, UK