Home » Pharmacology » 7-TM Receptors » Peptide Receptors » NPY Receptors » Neuropeptide Y (human, rat)

Neuropeptide Y (human, rat)

Cat. No. 1153

Neuropeptide Y (human) Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2

Price and Availability

For Neuropeptide Y (human, rat) pricing & availability please select your country from the drop down menu:
Submit

By clicking submit you agree to accept a cookie from Tocris Bioscience. For details, please read our privacy and cookie policy.

Alternative Name: NPY (human, rat)

Biological Activity

Widely distributed endogenous neuropeptide involved in the control of food intake, sexual behavior and blood pressure.

Technical Data

M.Wt:

4271.7

Formula:

C₁₈₉H₂₈₅N₅₅O₅₇S

Sequence:

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

(Modifications: Tyr-36 = C-terminal amide)

Solubility:

Soluble to 1.50 mg/ml in water

Storage:

Desiccate at -20°C

CAS No:

90880-35-6

The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.

Resources

Certificate of Analysis / Safety Data Sheet

Certificate of Analysis: View current batch

Select another batch:

Safety Data Sheet: View Safety Data Sheet

References

Minth et al (1984) Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine. Proc.Natl.Acad.Sci.U.S.A. 81 4577. PMID: 6589611.

Allen et al (1987) Molecular structure of mammalian neuropeptide Y: analysis by molecular cloning and computer-aided comparison with crystal structure of avian homologue. Proc.Natl.Acad.Sci.U.S.A. 84 2532. PMID: 3031687.

Michel et al (1998) XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 50 143. PMID: 9549761.

If you know of a relevant citation for this product please let us know.

View Related Products by Target

NPY Receptors

Peptide Receptors

Keywords: Neuropeptide Y (human), supplier, Influences, feeding, sexual, behavior, Neuropeptide, Y, Receptors, NPY, agonists, NeuropeptideY, (human), neuropeptides, Neuropeptide, Y, (human,, rat)

Quick Order

Find multiple products by catalog number

Appetite Modulation

Written by Sonia A. Tucci, Lynsay Kobelis & Tim Kirkham. Request a copy or view PDF today.

Regulation of Vascular Reactivity by GPCRs

Written by J.J. Maguire and A.P. Davenport

'Regulation of Vascular Reactivity by G-protein-coupled Receptors' summarizes the key GPCRs regulating vascular reactivity.

7-TM Receptor Signaling

Written by T. Kenakin et al

'Seven Transmembrane Receptor Signaling' highlights the multiple behaviors of 7-TMs including G-protein-dependent and -independent signaling as well as the concept of collateral efficacy